Lineage for d2yvaa_ (2yva A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.80: SIS domain [53696] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345Superfamily c.80.1: SIS domain [53697] (4 families) 
Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
dimer of mono-domain subunits
Protein automated matches [190898] (4 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [188327] (1 PDB entry) 
Domain d2yvaa_: 2yva A: [170881]
automated match to d1x92a_
Details for d2yvaa_
PDB Entry: 2yva (more details), 1.85 Å
PDB Description: Crystal structure of Escherichia coli DiaA
PDB Compounds: (A:) DnaA initiator-associating protein diaASCOPe Domain Sequences for d2yvaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvaa_ c.80.1.3 (A:) automated matches {Escherichia coli [TaxId: 562]}
mqerikacftesiqtqiaaaealpdaisraamtlvqsllngnkilccgngtsaanaqhfa
asminrfeterpslpaialntdnvvltaiandrlhdevyakqvralghagdvllaistrg
nsrdivkaveaavtrdmtivaltgydggelagllgpqdveiripshrsariqemhmltvn
clcdlidntlfph
SCOPe Domain Coordinates for d2yvaa_:
Click to download the PDB-style file with coordinates for d2yvaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2yvaa_:
- d2yvaa_ first appeared in SCOPe 2.01
- d2yvaa_ appears in SCOPe 2.07
View in 3D
