Lineage for d2ysia1 (2ysi A:5-37)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328562Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1328563Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1328564Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1328659Protein automated matches [192459] (2 species)
    not a true protein
  7. 1328666Species Mouse (Mus musculus) [TaxId:10090] [161326] (2 PDB entries)
  8. 1328668Domain d2ysia1: 2ysi A:5-37 [153751]
    automatically matched to d1e0ma_

Details for d2ysia1

PDB Entry: 2ysi (more details)

PDB Description: solution structure of the first ww domain from the mouse transcription elongation regulator 1, transcription factor ca150
PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2ysia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysia1 b.72.1.1 (A:5-37) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssgteeiwvenktpdgkvyyynartresawtkp

SCOPe Domain Coordinates for d2ysia1:

Click to download the PDB-style file with coordinates for d2ysia1.
(The format of our PDB-style files is described here.)

Timeline for d2ysia1: