Lineage for d2yqda_ (2yqd A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1488063Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries)
  8. 1488068Domain d2yqda_: 2yqd A: [244797]
    automated match to d3g0ja_

Details for d2yqda_

PDB Entry: 2yqd (more details)

PDB Description: solution structure of the fifth bromodomain from mouse polybromo-1
PDB Compounds: (A:) polybromo-1

SCOPe Domain Sequences for d2yqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yqda_ a.29.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikk
pmdmekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd

SCOPe Domain Coordinates for d2yqda_:

Click to download the PDB-style file with coordinates for d2yqda_.
(The format of our PDB-style files is described here.)

Timeline for d2yqda_: