Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries) |
Domain d2yqda_: 2yqd A: [244797] automated match to d3g0ja_ |
PDB Entry: 2yqd (more details)
SCOPe Domain Sequences for d2yqda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yqda_ a.29.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gssgssgkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikk pmdmekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd
Timeline for d2yqda_: