Lineage for d2yl7a_ (2yl7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312848Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2313134Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2313188Protein automated matches [190363] (5 species)
    not a true protein
  7. 2313189Species Achromobacter xylosoxidans [TaxId:85698] [189489] (29 PDB entries)
  8. 2313192Domain d2yl7a_: 2yl7 A: [170845]
    automated match to d1e83a_
    complexed with cmo, hec

Details for d2yl7a_

PDB Entry: 2yl7 (more details), 0.9 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution - restraint refinement
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d2yl7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yl7a_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkkk

SCOPe Domain Coordinates for d2yl7a_:

Click to download the PDB-style file with coordinates for d2yl7a_.
(The format of our PDB-style files is described here.)

Timeline for d2yl7a_: