Lineage for d2yind_ (2yin D:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (27 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries) 
Domain d2yind_: 2yin D: [170810]
automated match to d1foeb_
Details for d2yind_
PDB Entry: 2yin (more details), 2.7 Å
PDB Description: structure of the complex between dock2 and rac1.
PDB Compounds: (D:) ras-related c3 botulinum toxin substrate 1SCOPe Domain Sequences for d2yind_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yind_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgtmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
dtagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtk
ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
l
SCOPe Domain Coordinates for d2yind_:
Click to download the PDB-style file with coordinates for d2yind_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2yind_:
- d2yind_ first appeared in SCOPe 2.01
- d2yind_ appears in SCOPe 2.04
- d2yind_ is called d2yind1 in SCOPe 2.06
- d2yind_ appears in the current release, SCOPe 2.08, called d2yind1
View in 3D
