Lineage for d2yfwe_ (2yfw E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2699039Species Kluyveromyces lactis [TaxId:284590] [226140] (3 PDB entries)
  8. 2699045Domain d2yfwe_: 2yfw E: [207578]
    automated match to d2hioc_

Details for d2yfwe_

PDB Entry: 2yfw (more details), 2.6 Å

PDB Description: heterotetramer structure of kluyveromyces lactis cse4,h4
PDB Compounds: (E:) histone h3-like centromeric protein cse4

SCOPe Domain Sequences for d2yfwe_:

Sequence, based on SEQRES records: (download)

>d2yfwe_ a.22.1.1 (E:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
alaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgl
lehtnllalhakritimrkdmqlarrirgqfi

Sequence, based on observed residues (ATOM records): (download)

>d2yfwe_ a.22.1.1 (E:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
alaeirkyqrstdllisrmpfarlvkevtdqftplrwqsmaimalqeaseaylvglleht
nllalhakritimrkdmqlarrirgqfi

SCOPe Domain Coordinates for d2yfwe_:

Click to download the PDB-style file with coordinates for d2yfwe_.
(The format of our PDB-style files is described here.)

Timeline for d2yfwe_: