Lineage for d2y7ia_ (2y7i A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.0: automated matches [191309] (1 protein)
not a true familyProtein automated matches [190039] (161 species)
not a true protein
Species Salmonella typhimurium [TaxId:90371] [189953] (1 PDB entry) 
Domain d2y7ia_: 2y7i A: [170668]
automated match to d1lafe_
complexed with act, arg, gol, zn
Details for d2y7ia_
PDB Entry: 2y7i (more details), 1.9 Å
PDB Description: structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351.
PDB Compounds: (A:) stm4351SCOPe Domain Sequences for d2y7ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y7ia_ c.94.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
asvsartlhfgtsatyapyefvdadnkivgfdidvanavckemqaecsftnqsfdslips
lrfkkfdaviagmdmtpkreqqvsfsqpyyeglsavvvtrkgayhtfadlkgkkvgleng
tthqrylqdkqqaitpvaydsylnaftdlknnrlegvfgdvaaigkwlknnpdyaimder
asdpdyygkglgiavrkdndallqeinaaldkvkaspeyaqmqekwft
SCOPe Domain Coordinates for d2y7ia_:
Click to download the PDB-style file with coordinates for d2y7ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2y7ia_:
- d2y7ia_ first appeared in SCOPe 2.01
- d2y7ia_ appears in SCOPe 2.07
View in 3D
