Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (11 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:272560] [226139] (1 PDB entry) |
Domain d2y78a_: 2y78 A: [207492] automated match to d4dz3b_ complexed with cl, gol, so4 |
PDB Entry: 2y78 (more details), 0.91 Å
SCOPe Domain Sequences for d2y78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y78a_ d.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]} sglvprgshmtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrnd pfafvlgggmvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevell dv
Timeline for d2y78a_: