Lineage for d2y78a_ (2y78 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408629Species Burkholderia pseudomallei [TaxId:272560] [226139] (1 PDB entry)
  8. 1408630Domain d2y78a_: 2y78 A: [207492]
    automated match to d4dz3b_
    complexed with cl, gol, so4

Details for d2y78a_

PDB Entry: 2y78 (more details), 0.91 Å

PDB Description: crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2y78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y78a_ d.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
sglvprgshmtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrnd
pfafvlgggmvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevell
dv

SCOPe Domain Coordinates for d2y78a_:

Click to download the PDB-style file with coordinates for d2y78a_.
(The format of our PDB-style files is described here.)

Timeline for d2y78a_: