Lineage for d2y6da_ (2y6d A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1918283Protein automated matches [190182] (1 species)
    not a true protein
  7. 1918284Species Human (Homo sapiens) [TaxId:9606] [186920] (32 PDB entries)
  8. 1918301Domain d2y6da_: 2y6d A: [170651]
    automated match to d1mmra_
    complexed with ca, so4, tqj, zn

Details for d2y6da_

PDB Entry: 2y6d (more details), 1.6 Å

PDB Description: the discovery of mmp7 inhibitors exploiting a novel selectivity trigger
PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2y6da_:

Sequence, based on SEQRES records: (download)

>d2y6da_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtad
imigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaat
helghslgmghssdpnavmyptygngdpqnfklsqddikgiqklyg

Sequence, based on observed residues (ATOM records): (download)

>d2y6da_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtad
imigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaat
helghslgmghssdpnavmyptynfklsqddikgiqklyg

SCOPe Domain Coordinates for d2y6da_:

Click to download the PDB-style file with coordinates for d2y6da_.
(The format of our PDB-style files is described here.)

Timeline for d2y6da_: