Lineage for d2y3za_ (2y3z A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1619980Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1620086Protein automated matches [190072] (18 species)
    not a true protein
  7. 1620214Species Thermus thermophilus [TaxId:274] [189081] (6 PDB entries)
  8. 1620215Domain d2y3za_: 2y3z A: [170580]
    automated match to d1g2ua_
    complexed with 2pe, gol, trs

Details for d2y3za_

PDB Entry: 2y3z (more details), 1.83 Å

PDB Description: Structure of Isopropylmalate dehydrogenase from Thermus thermophilus - apo enzyme
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d2y3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y3za_ c.77.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
smkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrk
gveeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplk
eeiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkh
vvsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnif
gdilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammle
hafglvelarkvedavakalletpppdlggsagteaftatvlrhlaaaale

SCOPe Domain Coordinates for d2y3za_:

Click to download the PDB-style file with coordinates for d2y3za_.
(The format of our PDB-style files is described here.)

Timeline for d2y3za_: