Lineage for d2xz4a_ (2xz4 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
contains mixed beta-sheetSuperfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) 
Family d.118.1.0: automated matches [191348] (1 protein)
not a true familyProtein automated matches [190280] (9 species)
not a true proteinSpecies Fruit fly (Drosophila melanogaster) [TaxId:7227] [187079] (3 PDB entries) 
Domain d2xz4a_: 2xz4 A: [170492]
automated match to d2f2lx1
complexed with 1pg, cu, edo
Details for d2xz4a_
PDB Entry: 2xz4 (more details), 1.72 Å
PDB Description: crystal structure of the lfz ectodomain of the peptidoglycan recognition protein lf
PDB Compounds: (A:) peptidoglycan-recognition protein lfSCOPe Domain Sequences for d2xz4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xz4a_ d.118.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hildrsewlgeppsgkyphlklpvsniiihhtategceqedvciyrmktiqafhmksfgw
vdigynflvggdgqiyvgrgwhiqgqhvngygaisvsiafigtfvnmepparqieaakrl
mdegvrlhrlqpdyhiyahrqlsptespgqklfelmqnwprftqd
SCOPe Domain Coordinates for d2xz4a_:
Click to download the PDB-style file with coordinates for d2xz4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xz4a_:
- d2xz4a_ first appeared in SCOPe 2.01
- d2xz4a_ appears in SCOPe 2.06
- d2xz4a_ appears in the current release, SCOPe 2.08
View in 3D
