Lineage for d2xy2a1 (2xy2 A:19-113)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) 
Domain d2xy2a1: 2xy2 A:19-113 [207430]
automated match to d1epfa1
complexed with gol, nag
Details for d2xy2a1
PDB Entry: 2xy2 (more details), 1.82 Å
PDB Description: crystal structure of ncam2 ig1-2
PDB Compounds: (A:) Neural cell adhesion molecule 2SCOPe Domain Sequences for d2xy2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xy2a1 b.1.1.0 (A:19-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
allqvtislskvelsvgeskfftctaigepesidwynpqgekiistqrvvvqkegvrsrl
tiynaniedagiyrcqatdakgqtqeatvvleiyq
SCOPe Domain Coordinates for d2xy2a1:
Click to download the PDB-style file with coordinates for d2xy2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xy2a1:
- d2xy2a1 first appeared in SCOPe 2.03
- d2xy2a1 appears in SCOPe 2.07
View in 3D
