Lineage for d2xwlb_ (2xwl B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.0: automated matches [191551] (1 protein)
not a true familyProtein automated matches [190951] (23 species)
not a true proteinSpecies Mycobacterium smegmatis [TaxId:1772] [226120] (1 PDB entry) 
Domain d2xwlb_: 2xwl B: [207368]
automated match to d1vgta_
complexed with ctp, mg
Details for d2xwlb_
PDB Entry: 2xwl (more details), 1.49 Å
PDB Description: crystal structure of ispd from mycobacterium smegmatis in complex with ctp and mg
PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferaseSCOPe Domain Sequences for d2xwlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xwlb_ c.68.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
atvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltdes
klvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalkeg
hsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvtd
daslveqlgtpvqivdgdplafkittpldlvlaeavlahhhh
SCOPe Domain Coordinates for d2xwlb_:
Click to download the PDB-style file with coordinates for d2xwlb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xwlb_:
- d2xwlb_ first appeared in SCOPe 2.03
- d2xwlb_ appears in SCOPe 2.04
- d2xwlb_ is called d2xwlb1 in SCOPe 2.06
- d2xwlb_ appears in the current release, SCOPe 2.08, called d2xwlb1
View in 3D
