Lineage for d2xsha2 (2xsh A:180-459)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975906Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2975907Protein automated matches [190218] (21 species)
    not a true protein
  7. 2975910Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2975923Domain d2xsha2: 2xsh A:180-459 [231576]
    Other proteins in same PDB: d2xsha1, d2xshb_, d2xshc1, d2xshd_, d2xshe1, d2xshf_, d2xshg1, d2xshh_, d2xshi1, d2xshj_, d2xshk1, d2xshl_
    automated match to d2xr8c2
    complexed with dc5, fe2, fes

Details for d2xsha2

PDB Entry: 2xsh (more details), 2.29 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl
PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xsha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsha2 d.129.3.0 (A:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2xsha2:

Click to download the PDB-style file with coordinates for d2xsha2.
(The format of our PDB-style files is described here.)

Timeline for d2xsha2: