Class b: All beta proteins [48724] (180 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (2 families) |
Family b.72.1.0: automated matches [227264] (1 protein) not a true family |
Protein automated matches [227055] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226058] (20 PDB entries) |
Domain d2xp6a1: 2xp6 A:7-37 [207297] Other proteins in same PDB: d2xp6a2 automated match to d1f8ab1 complexed with 12p, 4g2 |
PDB Entry: 2xp6 (more details), 1.9 Å
SCOPe Domain Sequences for d2xp6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xp6a1 b.72.1.0 (A:7-37) automated matches {Human (Homo sapiens) [TaxId: 9606]} lppgwekamsrssgrvyyfnhitnasqwerp
Timeline for d2xp6a1: