Lineage for d2xjra_ (2xjr A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565881Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 1565882Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 1565923Family b.179.1.2: GLEYA domain [254187] (2 proteins)
    Pfam PF10528
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  6. 1565924Protein GLEYA domain [254411] (1 species)
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  7. 1565925Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [254850] (7 PDB entries)
  8. 1565928Domain d2xjra_: 2xjr A: [244526]
    complexed with ca, cl, gol, na

Details for d2xjra_

PDB Entry: 2xjr (more details), 1.25 Å

PDB Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and man5(d2-d3)
PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d2xjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjra_ b.179.1.2 (A:) GLEYA domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvg
gqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttpt
nvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingik
pwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvysf
dddlsqsnctipdpsih

SCOPe Domain Coordinates for d2xjra_:

Click to download the PDB-style file with coordinates for d2xjra_.
(The format of our PDB-style files is described here.)

Timeline for d2xjra_: