![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
![]() | Protein Putative transcription regulator CylR2 [109811] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries) Uniprot Q8VL32 |
![]() | Domain d2xi8a_: 2xi8 A: [170111] automated match to d1utxa_ complexed with gol |
PDB Entry: 2xi8 (more details), 1.21 Å
SCOPe Domain Sequences for d2xi8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xi8a_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi fqwqpe
Timeline for d2xi8a_: