Lineage for d2xi8a_ (2xi8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709463Protein Putative transcription regulator CylR2 [109811] (1 species)
  7. 2709464Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
    Uniprot Q8VL32
  8. 2709465Domain d2xi8a_: 2xi8 A: [170111]
    automated match to d1utxa_
    complexed with gol

Details for d2xi8a_

PDB Entry: 2xi8 (more details), 1.21 Å

PDB Description: high resolution structure of native cylr2
PDB Compounds: (A:) putative transcription regulator

SCOPe Domain Sequences for d2xi8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xi8a_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

SCOPe Domain Coordinates for d2xi8a_:

Click to download the PDB-style file with coordinates for d2xi8a_.
(The format of our PDB-style files is described here.)

Timeline for d2xi8a_: