Lineage for d2xhda_ (2xhd A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein automated matches [190140] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189406] (17 PDB entries)
  8. Domain d2xhda_: 2xhd A: [170092]
    automated match to d1lbcb_
    complexed with 7t9, glu, so4

Details for d2xhda_

PDB Entry: 2xhd (more details), 1.8 Å

PDB Description: crystal structure of n-((2s)-5-(6-fluoro-3-pyridinyl)-2,3-dihydro-1h-inden-2-yl)-2-propanesulfonamide in complex with the ligand binding domain of the human glua2 receptor
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2xhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhda_ c.94.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlkls
eqgvldklknkwwydkgecga

SCOPe Domain Coordinates for d2xhda_ are not available.

Timeline for d2xhda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xhdb_