Lineage for d2xfxa1 (2xfx A:1-181)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein automated matches [191280] (6 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [225910] (2 PDB entries) 
Domain d2xfxa1: 2xfx A:1-181 [198604]
Other proteins in same PDB: d2xfxa2, d2xfxa3, d2xfxb_
automated match to d1xh3a2
Details for d2xfxa1
PDB Entry: 2xfx (more details), 1.9 Å
PDB Description: cattle MHC class I N01301 presenting an 11mer from Theileria parva
PDB Compounds: (A:) MHC class 1SCOPe Domain Sequences for d2xfxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfxa1 d.19.1.1 (A:1-181) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gshslryfhtavsrpglreplfitvgyvddtqfvrfdsdardprteprqpwmekegpeyw
dretqiskenalwyrealnnlrgyynqseagshtlqemygcdvgsdgrlrrgyeqygydg
rdylalnedlrswtaadtaaqiskrkmeaagaaerfrnylegtcvewlrrylengkdtll
r
SCOPe Domain Coordinates for d2xfxa1:
Click to download the PDB-style file with coordinates for d2xfxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xfxa1:
- d2xfxa1 first appeared in SCOPe 2.03
- d2xfxa1 appears in SCOPe 2.07
View in 3D
