Lineage for d2xe3a_ (2xe3 A:)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
not a true fold, gathers together transmembrane barrels of different (n,S)
annotated by the SCOP(e) curators as 'not a true fold'
Superfamily f.4.3: Porins [56935] (5 families) 
Family f.4.3.1: Porin [56936] (2 proteins)
trimer, one subunit folds into (16,20) barrelProtein automated matches [190289] (7 species)
not a true protein
Species Escherichia coli [TaxId:562] [187889] (9 PDB entries) 
Domain d2xe3a_: 2xe3 A: [170052]
automated match to d1osma_
complexed with bog
Details for d2xe3a_
PDB Entry: 2xe3 (more details), 2.85 Å
PDB Description: ompc28
PDB Compounds: (A:) outer membrane porin cSCOPe Domain Sequences for d2xe3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xe3a_ f.4.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
atrvgslgwankaqnfeavaqyqfdfglrpflaylqskgknlgrgyddedilkyvdvgat
yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
SCOPe Domain Coordinates for d2xe3a_:
Click to download the PDB-style file with coordinates for d2xe3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xe3a_:
- d2xe3a_ first appeared in SCOPe 2.01
- d2xe3a_ appears in SCOPe 2.07
View in 3D
