Lineage for d2xdea_ (2xde A:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) Protein automated matches [190369] (6 species)
not a true protein
Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (6 PDB entries) 
Domain d2xdea_: 2xde A: [170044]
automated match to d1m9xc_
complexed with 1b0
Details for d2xdea_
PDB Entry: 2xde (more details), 1.4 Å
PDB Description: crystal structure of the complex of pf-3450074 with an engineered hiv capsid n terminal domain
PDB Compounds: (A:) gag polyproteinSCOPe Domain Sequences for d2xdea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xdea_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvgeprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmysg
SCOPe Domain Coordinates for d2xdea_:
Click to download the PDB-style file with coordinates for d2xdea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xdea_:
- d2xdea_ first appeared in SCOPe 2.01
- d2xdea_ appears in SCOPe 2.02
- d2xdea_ appears in SCOPe 2.04
- d2xdea_ appears in the current release, SCOPe 2.08, called d2xdea1
View in 3D
