![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces natalensis [TaxId:68242] [225950] (2 PDB entries) |
![]() | Domain d2xbka_: 2xbk A: [207174] automated match to d2nzaa_ complexed with hem, xbk |
PDB Entry: 2xbk (more details), 1.95 Å
SCOPe Domain Sequences for d2xbka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xbka_ a.104.1.0 (A:) automated matches {Streptomyces natalensis [TaxId: 68242]} dlpclnleppkmlklspllralqdrgpihrvrtpagdeawlvtrhaelkqllhderigrt hpdppsaaqyvrspfldllisdadaesgrrqhaetrrlltplfsarrvlemqpkveeaad tlldafiaqgppgdlhgeltvpfaltvlcevigvppqrraelttllagiaklddregavr aqddlfgyvaglvehkraepgpdiisrlndgeltedrvahlamgllfagldsvasimdng vvllaahpdqraaaladpdvmaraveevlrtaraggsvlppryasedmefggvtiragdl vlfdlglpnfderaftgpeefdaartpnphltfghgiwhcigaplarlelrtmftklftr lpelrpelpveqlrlkegqlsggfaelrvvw
Timeline for d2xbka_: