Lineage for d2xafb2 (2xaf B:376-440)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720667Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1720722Protein REST corepressor 1, CoREST [140165] (1 species)
  7. 1720723Species Human (Homo sapiens) [TaxId:9606] [140166] (22 PDB entries)
    Uniprot Q9UKL0 376-440
  8. 1720741Domain d2xafb2: 2xaf B:376-440 [264566]
    Other proteins in same PDB: d2xafa1, d2xafa2, d2xafa3, d2xafb1
    complexed with fad, tcf

Details for d2xafb2

PDB Entry: 2xaf (more details), 3.25 Å

PDB Description: crystal structure of lsd1-corest in complex with para-bromo-(+)-cis-2-phenylcyclopropyl-1-amine
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2xafb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xafb2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

SCOPe Domain Coordinates for d2xafb2:

Click to download the PDB-style file with coordinates for d2xafb2.
(The format of our PDB-style files is described here.)

Timeline for d2xafb2:

1720741
d2xafb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2xafb1