Lineage for d2x1la1 (2x1l A:2-353)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861016Species Mycobacterium smegmatis [TaxId:246196] [231529] (2 PDB entries)
  8. 2861017Domain d2x1la1: 2x1l A:2-353 [231530]
    Other proteins in same PDB: d2x1la2, d2x1lb1, d2x1lc1
    automated match to d4eg3b1
    protein/RNA complex; complexed with 2hp, adn, cxs, met

Details for d2x1la1

PDB Entry: 2x1l (more details), 2.3 Å

PDB Description: crystal structure of mycobacterium smegmatis methionyl-trna synthetase in complex with methionine and adenosine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2x1la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x1la1 c.26.1.0 (A:2-353) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sepfyittaiaypngvphighayeyiatdaiarfkrldgydvryltgtdvhgqkmaetaa
kegipaaelarrnsdvfqrlqeklnisfdrfirtsdadhyeaskaiwkrmadagdiylda
ykgwysirderfftenetteqpdgtriatetgapvtwteeqtyffrlsaytdrllalyee
hpefigpdarrneivsfvsgglkdlsisrttfdwgvpvpdhpdhvmyvwvdaltnyltgv
gfpdtesesfrrywpadlhmigkdiirfhtvywpaflmsaglplpkrifahgwllnrgek
msksignvvdpvnlvdtfgldqvryfllrevpfgqdgsynedaiigrvnadl

SCOPe Domain Coordinates for d2x1la1:

Click to download the PDB-style file with coordinates for d2x1la1.
(The format of our PDB-style files is described here.)

Timeline for d2x1la1:

2861017
d2x1la1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2x1la2