Lineage for d2x19a_ (2x19 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2867988Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)
  8. 2867999Domain d2x19a_: 2x19 A: [207097]
    automated match to d3gjxc_
    complexed with gtp, mg

Details for d2x19a_

PDB Entry: 2x19 (more details), 2.8 Å

PDB Description: crystal structure of importin13 - rangtp complex
PDB Compounds: (A:) GTP-binding nuclear protein GSP1/CNR1

SCOPe Domain Sequences for d2x19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x19a_ c.37.1.8 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gevptfklvlvgdggtgkttfvkrhltgefekkyiatigvevhplsfytnfgeikfdvwd
taglekfgglrdgyyinaqcaiimfdvtsrityknvpnwhrdlvrvcenipivlcgnkvd
vkerkvkaktitfhrkknlqyydisaksnynfekpflwlarklagnpqlefv

SCOPe Domain Coordinates for d2x19a_:

Click to download the PDB-style file with coordinates for d2x19a_.
(The format of our PDB-style files is described here.)

Timeline for d2x19a_: