Lineage for d2x0ia1 (2x0i A:22-163)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2453110Protein Malate dehydrogenase [51849] (13 species)
  7. 2453115Species Archaeoglobus fulgidus [TaxId:2234] [110427] (4 PDB entries)
    Uniprot O08349
  8. 2453118Domain d2x0ia1: 2x0i A:22-163 [169754]
    Other proteins in same PDB: d2x0ia2
    complexed with na, nai, so4

Details for d2x0ia1

PDB Entry: 2x0i (more details), 2.91 Å

PDB Description: 2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2x0ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0ia1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm

SCOPe Domain Coordinates for d2x0ia1:

Click to download the PDB-style file with coordinates for d2x0ia1.
(The format of our PDB-style files is described here.)

Timeline for d2x0ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x0ia2