Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries) |
Domain d2wy3a_: 2wy3 A: [244353] automated match to d1tmca_ complexed with act, nag, peu |
PDB Entry: 2wy3 (more details), 1.8 Å
SCOPe Domain Sequences for d2wy3a_:
Sequence, based on SEQRES records: (download)
>d2wy3a_ d.19.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksg
>d2wy3a_ d.19.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls qnletqestvpqssraqtlamnvtnfwkektkthyramqadclqklqrylksg
Timeline for d2wy3a_: