Lineage for d2wy3a_ (2wy3 A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.0: automated matches [227140] (1 protein)
not a true familyProtein automated matches [226842] (4 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries) 
Domain d2wy3a_: 2wy3 A: [244353]
automated match to d1tmca_
complexed with act, nag, peu
Details for d2wy3a_
PDB Entry: 2wy3 (more details), 1.8 Å
PDB Description: structure of the hcmv ul16-micb complex elucidates select binding of a viral immunoevasin to diverse nkg2d ligands
PDB Compounds: (A:) MHC class I polypeptide-related sequence bSCOPe Domain Sequences for d2wy3a_:
Sequence, based on SEQRES records: (download)
>d2wy3a_ d.19.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksg
Sequence, based on observed residues (ATOM records): (download)
>d2wy3a_ d.19.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
qnletqestvpqssraqtlamnvtnfwkektkthyramqadclqklqrylksg
SCOPe Domain Coordinates for d2wy3a_:
Click to download the PDB-style file with coordinates for d2wy3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wy3a_:
- d2wy3a_ is new in SCOPe 2.04-stable
- d2wy3a_ appears in SCOPe 2.05
- d2wy3a_ appears in the current release, SCOPe 2.08
View in 3D
