Lineage for d2wwua_ (2wwu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815818Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
    Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)
  6. 2816291Protein PHD finger protein 8 (PHF8) [419131] (1 species)
  7. 2816292Species Human (Homo sapiens) [TaxId:9606] [419653] (1 PDB entry)
  8. 2816293Domain d2wwua_: 2wwu A: [413008]
    complexed with act, bgc, ni, so4

Details for d2wwua_

PDB Entry: 2wwu (more details), 2.15 Å

PDB Description: crystal structure of the catalytic domain of phd finger protein 8
PDB Compounds: (A:) phd finger protein 8

SCOPe Domain Sequences for d2wwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wwua_ b.82.2.14 (A:) PHD finger protein 8 (PHF8) {Human (Homo sapiens) [TaxId: 9606]}
vktgsptfvrelrsrtfdssdevilkptgnqltvefleensfsvpilvlkkdglgmtlps
psftvrdvehyvgsdkeidvidvtrqadckmklgdfvkyyysgkrekvlnvislefsdtr
lsnlvetpkivrklswvenlwpeecvferpnvqkyclmsvrdsytdfhidfggtsvwyhv
lkgekifylirptnanltlfecwssssnqnemffgdqvdkcykcsvkqgqtlfiptgwih
avltpvdclafggnflhslniemqlkayeiekrlstadlfrfpnfeticwyvgkhildif
rglrenrrhpasylvhggkalnlafrawtrkealpdhedeipetvrtvqlikdlareirl
ved

SCOPe Domain Coordinates for d2wwua_:

Click to download the PDB-style file with coordinates for d2wwua_.
(The format of our PDB-style files is described here.)

Timeline for d2wwua_:

  • d2wwua_ is new in SCOPe 2.08-stable