Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.0: automated matches [227175] (1 protein) not a true family |
Protein automated matches [226892] (5 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries) |
Domain d2wvcb2: 2wvc B:61-148 [231508] Other proteins in same PDB: d2wvca1, d2wvcb1 automated match to d2bj9a2 complexed with fmt, gol, so4 |
PDB Entry: 2wvc (more details), 2.1 Å
SCOPe Domain Sequences for d2wvcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvcb2 d.58.18.0 (B:61-148) automated matches {Helicobacter pylori [TaxId: 85962]} deskiavlvviydggqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei qrlqleigglrgvkfakltkassfeyne
Timeline for d2wvcb2: