Lineage for d2wuga_ (2wug A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617944Species Mycobacterium tuberculosis [TaxId:83332] [189096] (5 PDB entries)
  8. 1617945Domain d2wuga_: 2wug A: [169644]
    automated match to d2puha1
    complexed with gol, hpk, scn; mutant

Details for d2wuga_

PDB Entry: 2wug (more details), 1.8 Å

PDB Description: crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopda
PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphd

SCOPe Domain Sequences for d2wuga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wuga_ c.69.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflgg

SCOPe Domain Coordinates for d2wuga_:

Click to download the PDB-style file with coordinates for d2wuga_.
(The format of our PDB-style files is described here.)

Timeline for d2wuga_: