Lineage for d2wtrb1 (2wtr B:2-175)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) Protein automated matches [227018] (2 species)
not a true proteinSpecies Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries) 
Domain d2wtrb1: 2wtr B:2-175 [231495]
Other proteins in same PDB: d2wtra1, d2wtra2, d2wtrb2
automated match to d1g4ma1
complexed with ba
Details for d2wtrb1
PDB Entry: 2wtr (more details), 2.9 Å
PDB Description: full length arrestin2
PDB Compounds: (B:) beta-arrestin-1SCOPe Domain Sequences for d2wtrb1:
Sequence, based on SEQRES records: (download)
>d2wtrb1 b.1.18.11 (B:2-175) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcaf
rygredldvvgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeipp
nlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
Sequence, based on observed residues (ATOM records): (download)
>d2wtrb1 b.1.18.11 (B:2-175) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcaf
rygrvgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpcs
vtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
SCOPe Domain Coordinates for d2wtrb1:
Click to download the PDB-style file with coordinates for d2wtrb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wtrb1:
- d2wtrb1 first appeared in SCOPe 2.03
- d2wtrb1 appears in SCOPe 2.06
- d2wtrb1 appears in the current release, SCOPe 2.08
View in 3D
