Lineage for d2wqka_ (2wqk A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.106: SurE-like [64166] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7Superfamily c.106.1: SurE-like [64167] (2 families) 
some topological similarity to the N-terminal domain of Glutaminase/Asparaginase familyFamily c.106.1.0: automated matches [191430] (1 protein)
not a true familyProtein automated matches [190619] (7 species)
not a true proteinSpecies Aquifex aeolicus [TaxId:224324] [189062] (2 PDB entries) 
Domain d2wqka_: 2wqk A: [169567]
automated match to d1ilvb_
complexed with na, so4
Details for d2wqka_
PDB Entry: 2wqk (more details), 1.5 Å
PDB Description: crystal structure of sure protein from aquifex aeolicus
PDB Compounds: (A:) 5'-nucleotidase sureSCOPe Domain Sequences for d2wqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqka_ c.106.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
ptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtdf
ytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgip
siafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrqg
kraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykvm
ksikyled
SCOPe Domain Coordinates for d2wqka_:
Click to download the PDB-style file with coordinates for d2wqka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wqka_:
- d2wqka_ first appeared in SCOPe 2.01
- d2wqka_ appears in SCOPe 2.05
- d2wqka_ appears in SCOPe 2.07
- d2wqka_ appears in the current release, SCOPe 2.08
View in 3D
