Lineage for d2wq7a2 (2wq7 A:216-509)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721241Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2721242Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2721307Family a.99.1.0: automated matches [231382] (1 protein)
    not a true family
  6. 2721308Protein automated matches [231383] (3 species)
    not a true protein
  7. 2721312Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (8 PDB entries)
  8. 2721313Domain d2wq7a2: 2wq7 A:216-509 [244206]
    Other proteins in same PDB: d2wq7a1
    automated match to d2wb2a2
    protein/DNA complex; complexed with fad

Details for d2wq7a2

PDB Entry: 2wq7 (more details), 2 Å

PDB Description: structure of the 6-4 photolyase of d. melanogaster in complex with the non-natural n4-methyl t(6-4)c lesion
PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d2wq7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wq7a2 a.99.1.0 (A:216-509) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf
nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd
hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll
ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy
epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnrevrtgke

SCOPe Domain Coordinates for d2wq7a2:

Click to download the PDB-style file with coordinates for d2wq7a2.
(The format of our PDB-style files is described here.)

Timeline for d2wq7a2:

2721313
d2wq7a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2wq7a1