Lineage for d2wo1a_ (2wo1 A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-rollSuperfamily b.18.1: Galactose-binding domain-like [49785] (35 families) 
Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
automatically mapped to Pfam PF01404
Protein automated matches [190969] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries) 
Domain d2wo1a_: 2wo1 A: [169498]
automated match to d1kgya_
complexed with pol
Details for d2wo1a_
PDB Entry: 2wo1 (more details), 1.85 Å
PDB Description: crystal structure of the epha4 ligand binding domain
PDB Compounds: (A:) ephrin type-a receptorSCOPe Domain Sequences for d2wo1a_:
Sequence, based on SEQRES records: (download)
>d2wo1a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etgevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrt
dwitregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkid
tiaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykrtkh
hhh
Sequence, based on observed residues (ATOM records): (download)
>d2wo1a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etgevtlldsrsvqgelgwiaspleggweevsimdkntpirtyqvcnvmepsqnnwlrtd
witregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidt
iaadesftqvddrimklnteirdvgplskkgfylafqdvgacialvsvrvfykrtkhhhh
SCOPe Domain Coordinates for d2wo1a_:
Click to download the PDB-style file with coordinates for d2wo1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wo1a_:
- d2wo1a_ first appeared in SCOPe 2.01
- d2wo1a_ appears in SCOPe 2.04
- d2wo1a_ is called d2wo1a1 in SCOPe 2.06
- d2wo1a_ appears in the current release, SCOPe 2.08, called d2wo1a1
View in 3D
