![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies) sandwich, 10 strands in 2 sheets; "folded meander" |
![]() | Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) ![]() C-terminal half of Pfam PF08307 Slightly different topology from Hyaluronate lyase; contains helical insert |
![]() | Family b.24.2.1: Glycosyl hydrolase family 98 C-terminal domain [310645] (1 protein) |
![]() | Protein Sp4GH98 [310791] (1 species) |
![]() | Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [311049] (1 PDB entry) |
![]() | Domain d2wmfa2: 2wmf A:426-589 [304586] Other proteins in same PDB: d2wmfa1 |
PDB Entry: 2wmf (more details), 1.5 Å
SCOPe Domain Sequences for d2wmfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wmfa2 b.24.2.1 (A:426-589) Sp4GH98 {Streptococcus pneumoniae TIGR4 [TaxId: 170187]} yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlsg htghkpqinisgdknhytytenwdenthvytitvnhngmvemsi
Timeline for d2wmfa2: