| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
| Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species) |
| Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (4 PDB entries) Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690 |
| Domain d2wlka2: 2wlk A:139-295 [231447] Other proteins in same PDB: d2wlka1, d2wlka3, d2wlkb1, d2wlkb3 automated match to d1xl4a1 complexed with cl, k, spm |
PDB Entry: 2wlk (more details), 2.8 Å
SCOPe Domain Sequences for d2wlka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wlka2 b.1.18.16 (A:139-295) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq
Timeline for d2wlka2: