Lineage for d2wlka1 (2wlk A:11-138)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252675Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)
  7. 2252676Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
    Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
  8. 2252683Domain d2wlka1: 2wlk A:11-138 [231445]
    Other proteins in same PDB: d2wlka2, d2wlka3, d2wlkb2, d2wlkb3
    automated match to d1xl4a2
    complexed with cl, k, spm

Details for d2wlka1

PDB Entry: 2wlk (more details), 2.8 Å

PDB Description: structure of the atp-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum
PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2wlka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wlka1 f.14.1.1 (A:11-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl
iyarftrp

SCOPe Domain Coordinates for d2wlka1:

Click to download the PDB-style file with coordinates for d2wlka1.
(The format of our PDB-style files is described here.)

Timeline for d2wlka1: