Lineage for d2wl3b2 (2wl3 B:135-287)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (26 species)
not a true protein
Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries) 
Domain d2wl3b2: 2wl3 B:135-287 [206878]
automated match to d1hana2
complexed with ca, fe, gol
Details for d2wl3b2
PDB Entry: 2wl3 (more details), 2.2 Å
PDB Description: crystal structure of catechol 2,3-dioxygenase
PDB Compounds: (B:) catechol 2,3-dioxygenaseSCOPe Domain Sequences for d2wl3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl3b2 d.32.1.0 (B:135-287) automated matches {Rhodococcus sp. [TaxId: 186196]}
pmfgkfvtegqglghiiireddveeatrfyrllglegaveykfalpngavgtpvfmhcnd
rhhslafgvgpmdkrinhlmieythlddlgyahdlvrqqkidvtlqigkhsndealtfyc
anpsgwlwepgwgsrpapaqqehylrdifghdn
SCOPe Domain Coordinates for d2wl3b2:
Click to download the PDB-style file with coordinates for d2wl3b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wl3b2:
- d2wl3b2 first appeared in SCOPe 2.03
- d2wl3b2 appears in SCOPe 2.07
View in 3D
