Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries) |
Domain d2wl3b1: 2wl3 B:1-134 [206877] automated match to d1lkda1 complexed with ca, fe, gol |
PDB Entry: 2wl3 (more details), 2.2 Å
SCOPe Domain Sequences for d2wl3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl3b1 d.32.1.0 (B:1-134) automated matches {Rhodococcus sp. [TaxId: 186196]} makvtelgylglsvsnldawrdyaagimgmqvvddgeddriylrmdrwhhrivlhadgsd dlayigwrvagpveldelaeqlknagipfevasdadaaerrvlglvklhdpggnpteify gpqvdtsspfhpgr
Timeline for d2wl3b1: