Lineage for d2wl0a_ (2wl0 A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrel
Protein automated matches [190433] (11 species)
not a true protein
Species Human immunodeficiency virus type 1 (z2/cdc-z34 isolate) [TaxId:11683] [189175] (1 PDB entry) 
Domain d2wl0a_: 2wl0 A: [169427]
automated match to d1k6ca_
complexed with 5ah
Details for d2wl0a_
PDB Entry: 2wl0 (more details), 1.9 Å
PDB Description: hiv-1 protease inhibitors containing a tertiary alcohol in the transition-state mimic with improved cell-based antiviral activity
PDB Compounds: (A:) ProteaseSCOPe Domain Sequences for d2wl0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl0a_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus type 1 (z2/cdc-z34 isolate) [TaxId: 11683]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf
SCOPe Domain Coordinates for d2wl0a_:
Click to download the PDB-style file with coordinates for d2wl0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wl0a_:
- d2wl0a_ first appeared in SCOPe 2.01
- d2wl0a_ appears in SCOPe 2.05
- d2wl0a_ appears in SCOPe 2.07
- d2wl0a_ appears in the current release, SCOPe 2.08
View in 3D
