Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (11 species) not a true protein |
Species Human immunodeficiency virus type 1 (z2/cdc-z34 isolate) [TaxId:11683] [189175] (1 PDB entry) |
Domain d2wl0a_: 2wl0 A: [169427] automated match to d1k6ca_ complexed with 5ah |
PDB Entry: 2wl0 (more details), 1.9 Å
SCOPe Domain Sequences for d2wl0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl0a_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus type 1 (z2/cdc-z34 isolate) [TaxId: 11683]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptptnvigrnlltqigctlnf
Timeline for d2wl0a_: