Lineage for d2wkta1 (2wkt A:3-268)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2524206Protein automated matches [231410] (2 species)
    not a true protein
  7. 2524242Species Zoogloea ramigera [TaxId:350] [231411] (6 PDB entries)
  8. 2524243Domain d2wkta1: 2wkt A:3-268 [231412]
    Other proteins in same PDB: d2wkta2, d2wktb2, d2wktc2, d2wktd2
    automated match to d1qfla1
    complexed with cl, coa, k, na, so4; mutant

Details for d2wkta1

PDB Entry: 2wkt (more details), 2 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the n316a mutant with coenzyme a.
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wkta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkta1 c.95.1.1 (A:3-268) automated matches {Zoogloea ramigera [TaxId: 350]}
psiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpage
gqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsma
phcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavas
qnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvt
agnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d2wkta1:

Click to download the PDB-style file with coordinates for d2wkta1.
(The format of our PDB-style files is described here.)

Timeline for d2wkta1: