Lineage for d2whla_ (2whl A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820332Species Bacillus agaradhaerens [TaxId:76935] [231408] (2 PDB entries)
  8. 1820333Domain d2whla_: 2whl A: [231409]
    automated match to d1bqca_
    complexed with act

Details for d2whla_

PDB Entry: 2whl (more details), 1.4 Å

PDB Description: understanding how diverse mannanases recognise heterogeneous substrates
PDB Compounds: (A:) beta-mannanase

SCOPe Domain Sequences for d2whla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whla_ c.1.8.0 (A:) automated matches {Bacillus agaradhaerens [TaxId: 76935]}
gfsvdgntlydangqpfvmrginhghawykdtastaipaiaeqgantirivlsdggqwek
ddidtirevielaeqnkmvavvevhdatgrdsrsdlnravdywiemkdaligkedtviin
ianewygswdgsawadgyidvipklrdaglthtlmvdaagwgqypqsihdygqdvfnadp
lkntmfsihmyeyaggdantvrsnidrvidqdlalvigefghrhtdvdedtilsyseetg
tgwlawswkgnstswdyldlsedwagqhltdwgnrivhgadglqetskpstvft

SCOPe Domain Coordinates for d2whla_:

Click to download the PDB-style file with coordinates for d2whla_.
(The format of our PDB-style files is described here.)

Timeline for d2whla_: