Lineage for d2wfha_ (2wfh A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353403Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1353461Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1353640Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1353641Protein automated matches [190787] (6 species)
    not a true protein
  7. 1353642Species Human (Homo sapiens) [TaxId:9606] [188042] (7 PDB entries)
  8. 1353644Domain d2wfha_: 2wfh A: [169305]
    automated match to d1w8aa_
    complexed with so4

Details for d2wfha_

PDB Entry: 2wfh (more details), 1.8 Å

PDB Description: the human slit 2 dimerization domain d4
PDB Compounds: (A:) slit homolog 2 protein c-product

SCOPe Domain Sequences for d2wfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wfha_ c.10.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptectcldtvvrcsnkglkvlpkgiprdvtelyldgnqftlvpkelsnykhltlidlsn
nristlsnqsfsnmtqlltlilsynrlrcipprtfdglkslrllslhgndisvvpegafn
dlsalshlaiganplycdcnmqwlsdwvkseykepgiarcagpgemadklllttpskkft
c

SCOPe Domain Coordinates for d2wfha_:

Click to download the PDB-style file with coordinates for d2wfha_.
(The format of our PDB-style files is described here.)

Timeline for d2wfha_: