Lineage for d2wc1a_ (2wc1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856472Protein automated matches [190443] (6 species)
    not a true protein
  7. 2856499Species Rhodobacter capsulatus [TaxId:1061] [189322] (1 PDB entry)
  8. 2856500Domain d2wc1a_: 2wc1 A: [169197]
    automated match to d1yoba1
    complexed with fmn

Details for d2wc1a_

PDB Entry: 2wc1 (more details), 2.17 Å

PDB Description: Three-dimensional Structure of the Nitrogen Fixation Flavodoxin (NifF) from Rhodobacter capsulatus at 2.2 A
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2wc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wc1a_ c.23.5.1 (A:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
makiglffgsdtgttrkiakqikdmfddevmakplnvnradvadfmaydflilgtptlgd
gqlpglsanaasesweeflpriadqdfsgktialfglgdqvtyplefvnalfflheffsd
rganvvgrwpakgygfedslavvegeflglaldqdnqaaltperlkgwlsliaadfglvl
pa

SCOPe Domain Coordinates for d2wc1a_:

Click to download the PDB-style file with coordinates for d2wc1a_.
(The format of our PDB-style files is described here.)

Timeline for d2wc1a_: