Lineage for d2waxc_ (2wax C:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (158 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) 
Domain d2waxc_: 2wax C: [206746]
automated match to d1t5ia_
protein/RNA complex; complexed with cxs, po4
Details for d2waxc_
PDB Entry: 2wax (more details), 2.3 Å
PDB Description: structure of the human ddx6 c-terminal domain in complex with an edc3-fdf peptide
PDB Compounds: (C:) ATP-dependent RNA helicase ddx6SCOPe Domain Sequences for d2waxc_:
Sequence, based on SEQRES records: (download)
>d2waxc_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgyscfyiha
kmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhrigrsg
rfghlglainlityddrfnlksieeqlgteikpipsnidkslyvae
Sequence, based on observed residues (ATOM records): (download)
>d2waxc_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgyscfyiha
kmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhrigsgr
fghlglainlityddrfnlksieeqlgteikpipsnidkslyvae
SCOPe Domain Coordinates for d2waxc_:
Click to download the PDB-style file with coordinates for d2waxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2waxc_:
- d2waxc_ first appeared in SCOPe 2.03
- d2waxc_ appears in SCOPe 2.07
View in 3D
