Lineage for d2w9jb_ (2w9j B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946817Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 2946818Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (2 families) (S)
  5. 2946834Family d.49.1.0: automated matches [196602] (1 protein)
    not a true family
  6. 2946835Protein automated matches [196603] (1 species)
    not a true protein
  7. 2946836Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [196604] (1 PDB entry)
  8. 2946838Domain d2w9jb_: 2w9j B: [196605]
    automated match to d1e8ob_

Details for d2w9jb_

PDB Entry: 2w9j (more details), 2.6 Å

PDB Description: the crystal structure of srp14 from the schizosaccharomyces pombe signal recognition particle
PDB Compounds: (B:) signal recognition particle subunit srp14

SCOPe Domain Sequences for d2w9jb_:

Sequence, based on SEQRES records: (download)

>d2w9jb_ d.49.1.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mllsneeflkkltdllqthqskgtgsvylsqkcnpvdegegssasvliraksgaaekist
vveldyftdffqsyaevckgqivg

Sequence, based on observed residues (ATOM records): (download)

>d2w9jb_ d.49.1.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mllsneeflkkltdllqthqskgtgsvylsqkcnpvdegssasvliraksgaaekistvv
eldyftdffqsyaevckgqivg

SCOPe Domain Coordinates for d2w9jb_:

Click to download the PDB-style file with coordinates for d2w9jb_.
(The format of our PDB-style files is described here.)

Timeline for d2w9jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2w9ja_