Lineage for d2w70a1 (2w70 A:1-114)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591384Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1591385Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1591386Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1591393Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1591396Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)
  8. 1591397Domain d2w70a1: 2w70 A:1-114 [206678]
    Other proteins in same PDB: d2w70a2, d2w70a3, d2w70b2, d2w70b3
    automated match to d1dv1a2
    complexed with cl, l22

Details for d2w70a1

PDB Entry: 2w70 (more details), 1.77 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with the amino-thiazole-pyrimidine fragment
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2w70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w70a1 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d2w70a1:

Click to download the PDB-style file with coordinates for d2w70a1.
(The format of our PDB-style files is described here.)

Timeline for d2w70a1: