Lineage for d2w57a_ (2w57 A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.0: automated matches [191329] (1 protein)
not a true familyProtein automated matches [190154] (92 species)
not a true protein
Species Vibrio cholerae [TaxId:666] [225592] (1 PDB entry) 
Domain d2w57a_: 2w57 A: [206628]
automated match to d3eyyb_
complexed with zn
Details for d2w57a_
PDB Entry: 2w57 (more details), 2.6 Å
PDB Description: crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains
PDB Compounds: (A:) ferric uptake regulation proteinSCOPe Domain Sequences for d2w57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w57a_ a.4.5.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
dnnqalkdaglkvtlprlkilevlqqpecqhisaeelykklidlgeeiglatvyrvlnqf
ddagivtrhhfeggksvfelstqhhhdhlvcldcgeviefsddvieqrqkeiaakynvql
tnhslylygkc
SCOPe Domain Coordinates for d2w57a_:
Click to download the PDB-style file with coordinates for d2w57a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2w57a_:
- d2w57a_ first appeared in SCOPe 2.03
- d2w57a_ appears in SCOPe 2.07
View in 3D
