Lineage for d2w57a_ (2w57 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695198Species Vibrio cholerae [TaxId:666] [225592] (1 PDB entry)
  8. 2695199Domain d2w57a_: 2w57 A: [206628]
    automated match to d3eyyb_
    complexed with zn

Details for d2w57a_

PDB Entry: 2w57 (more details), 2.6 Å

PDB Description: crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d2w57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w57a_ a.4.5.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
dnnqalkdaglkvtlprlkilevlqqpecqhisaeelykklidlgeeiglatvyrvlnqf
ddagivtrhhfeggksvfelstqhhhdhlvcldcgeviefsddvieqrqkeiaakynvql
tnhslylygkc

SCOPe Domain Coordinates for d2w57a_:

Click to download the PDB-style file with coordinates for d2w57a_.
(The format of our PDB-style files is described here.)

Timeline for d2w57a_: