Lineage for d2w37a2 (2w37 A:157-343)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906970Species Lactobacillus hilgardii [TaxId:1588] [225787] (1 PDB entry)
  8. 2906972Domain d2w37a2: 2w37 A:157-343 [206582]
    automated match to d1dxha2
    complexed with ni

Details for d2w37a2

PDB Entry: 2w37 (more details), 2.1 Å

PDB Description: crystal structure of the hexameric catabolic ornithine transcarbamylase from lactobacillus hilgardii
PDB Compounds: (A:) ornithine carbamoyltransferase, catabolic

SCOPe Domain Sequences for d2w37a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w37a2 c.78.1.0 (A:157-343) automated matches {Lactobacillus hilgardii [TaxId: 1588]}
klqgltltfmgdgrnnvansllvtgailgvnihivapkalfpteetqniakgfaeksgak
lvitddldeglkgsnvvytdvwvsmgesnweervkeltpyqvnmeamkktgtpddqlifm
hclpafhntdtqygkeikekygitemevtdevftskyarqfeeaenrmhsikammaatlg
nlfiprv

SCOPe Domain Coordinates for d2w37a2:

Click to download the PDB-style file with coordinates for d2w37a2.
(The format of our PDB-style files is described here.)

Timeline for d2w37a2: