Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Lactobacillus hilgardii [TaxId:1588] [225787] (1 PDB entry) |
Domain d2w37a2: 2w37 A:157-343 [206582] automated match to d1dxha2 complexed with ni |
PDB Entry: 2w37 (more details), 2.1 Å
SCOPe Domain Sequences for d2w37a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w37a2 c.78.1.0 (A:157-343) automated matches {Lactobacillus hilgardii [TaxId: 1588]} klqgltltfmgdgrnnvansllvtgailgvnihivapkalfpteetqniakgfaeksgak lvitddldeglkgsnvvytdvwvsmgesnweervkeltpyqvnmeamkktgtpddqlifm hclpafhntdtqygkeikekygitemevtdevftskyarqfeeaenrmhsikammaatlg nlfiprv
Timeline for d2w37a2:
View in 3D Domains from other chains: (mouse over for more information) d2w37b1, d2w37b2, d2w37c1, d2w37c2 |