Lineage for d2w0ra_ (2w0r A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011638Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily)
    alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest
  4. 3011639Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) (S)
  5. 3011657Family d.367.1.0: automated matches [191577] (1 protein)
    not a true family
  6. 3011658Protein automated matches [191013] (4 species)
    not a true protein
  7. 3011665Species Yersinia enterocolitica [TaxId:630] [267805] (2 PDB entries)
  8. 3011666Domain d2w0ra_: 2w0r A: [264531]
    automated match to d2jlja_
    complexed with cl

Details for d2w0ra_

PDB Entry: 2w0r (more details), 1.55 Å

PDB Description: crystal structure of the mutated n263d yscu c-terminal domain
PDB Compounds: (A:) yscu

SCOPe Domain Sequences for d2w0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0ra_ d.367.1.0 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]}
kreykemegspeikskrrqfhqeiqsgnmrenvkrssvvvadpthiaigilykrgetplp
lvtfkytdaqvqtvrkiaeeegvpilqriplaralywdalvdhyipaeqieataevlrwl
er

SCOPe Domain Coordinates for d2w0ra_:

Click to download the PDB-style file with coordinates for d2w0ra_.
(The format of our PDB-style files is described here.)

Timeline for d2w0ra_: