Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily) alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest |
Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) |
Family d.367.1.0: automated matches [191577] (1 protein) not a true family |
Protein automated matches [191013] (4 species) not a true protein |
Species Yersinia enterocolitica [TaxId:630] [267805] (2 PDB entries) |
Domain d2w0ra_: 2w0r A: [264531] automated match to d2jlja_ complexed with cl |
PDB Entry: 2w0r (more details), 1.55 Å
SCOPe Domain Sequences for d2w0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0ra_ d.367.1.0 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]} kreykemegspeikskrrqfhqeiqsgnmrenvkrssvvvadpthiaigilykrgetplp lvtfkytdaqvqtvrkiaeeegvpilqriplaralywdalvdhyipaeqieataevlrwl er
Timeline for d2w0ra_: